Cheap Kumara & Baked Bean Breakfast Bowl
A recipe from New Zealand.
🇳🇿 New ZealandbowlkumarabakedBeansbreakfastcheapsimplevegetarianquickMeallowCalorieheartHealthybeginnerFriendly
Nutrition (per serving)
350Calories
16 gProtein
58 gCarbs
6 gFat
12 gSugar
900 mgSalt
Ingredients
- 800 g Kumara (cubed)
- 800 g Canned baked beans
- 4 Eggs (optional)
- 1 tbsp Olive oil
- to taste Salt & pepper
- to serve Chilli sauce (optional)
Method
- Boil or microwave kumara cubes until soft (10–12 min), drain and season with salt & pepper.
- Heat baked beans in small pot or microwave until hot.
- Fry or poach eggs if using.
- Divide kumara and beans into bowls, top with egg if using. Add chilli sauce for kick – ultra-cheap, filling NZ breakfast bowl.
Match meals to your macros
Find meals that fit your calorie and protein targets, free.
Try it free in BmarchaiMore from New Zealand
Kumara & Bacon Salad
380 kcal · 12 g proteinSteamed Vegetable Dumplings
320 kcal · 12 g proteinKumara & Avocado Rice Bowl
460 kcal · 10 g proteinKumara & Coconut Red Lentil Soup
340 kcal · 14 g proteinSmoked Salmon & Dill Potato Salad
420 kcal · 24 g proteinKiwifruit, Strawberry & Yoghurt Shake
260 kcal · 12 g proteinGeneral fitness and nutrition information, not medical advice. Check with a qualified professional before starting a new exercise or diet plan, especially if you have an injury or health condition.